PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA57G00050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 344aa    MW: 38522.3 Da    PI: 5.6471
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA57G00050genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.6e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W  eEd+ll ++++++G g+W++ ++  g++R++k+c++rw +yl
       AA57G00050 15 KGPWLSEEDDLLTNYINEHGYGNWRSLPKLAGLNRCGKSCRLRWMNYL 62
                     79********************************************97 PP

2Myb_DNA-binding55.91e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+  +v+++++lG++ W++Ia +++ gRt++++k++w++++
       AA57G00050  68 RGKFSDEEETTIVRLHALLGNK-WSKIAGHLP-GRTDNEIKNYWNTHM 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.571062IPR017930Myb domain
SuperFamilySSF466891.84E-2912109IPR009057Homeodomain-like
SMARTSM007174.9E-121464IPR001005SANT/Myb domain
PfamPF002492.0E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221669IPR009057Homeodomain-like
CDDcd001677.86E-101762No hitNo description
PROSITE profilePS5129427.19963117IPR017930Myb domain
SMARTSM007179.0E-1667115IPR001005SANT/Myb domain
PfamPF002495.6E-1668112IPR001005SANT/Myb domain
CDDcd001677.80E-1270113No hitNo description
Gene3DG3DSA:1.10.10.607.0E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MVRSPCCDQD KGVKKGPWLS EEDDLLTNYI NEHGYGNWRS LPKLAGLNRC GKSCRLRWMN  60
YLRPDIRRGK FSDEEETTIV RLHALLGNKW SKIAGHLPGR TDNEIKNYWN THMRKKLLQM  120
GIDPNTHQPR TDLSSVLDLS QLVAAAVSPR QFGNNNMFNN SNTTTLEDLL KLQFIHNMLQ  180
IIAPKTVPNF NSAKPGLASG QLNDIDPHFF MNNNGINLEG MPLNENVFEI EENRVLTTRT  240
GDLWDGFEDN RLPGLVTISQ ENSGTTKPGT STKEVNNQTG TGLIGHFGDQ LREIPFSGSV  300
SVSPAVSGLT KPGTDQVSPG LDVIEDWEKL LDDESDSCWK SFLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C7e-26151174105C-Myb DNA-Binding Domain
1mse_C7e-26151174105C-Myb DNA-Binding Domain
1gv2_A7e-26151174105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00438DAPTransfer from AT4G17785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285445.11e-161hypothetical protein CARUB_v10006864mg
SwissprotQ8GWP01e-155MYB39_ARATH; Transcription factor MYB39
TrEMBLR0H4841e-161R0H484_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__2528__AT4G17785.11e-153(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122431730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.11e-136myb domain protein 39